EFCAB4B Antibody
| Name | EFCAB4B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48692 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:KEEPHLLSNFEDFLTRIISQLQEAHEEKNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQFLLKDTERFQARSQELEQKLLCK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | EFCAB4B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CRACR2A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: EFCAB4B Antibody [NBP2-48692] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7591_EFCAB4B%2520Antibody-Western%2520Blot-NBP2-48692-img0002.jpg)
![Immunohistochemistry: EFCAB4B Antibody [NBP2-48692] - Staining of human small intestine shows strong membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7592_EFCAB4B-Antibody-Immunohistochemistry-NBP2-48692-img0001.jpg)