RFX6 Antibody
| Name | RFX6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48677 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:SHCSTYPEPIYPTLPQANHDFYSTSSNYQTVFRAQPHSTSGLYPHHTEHGRCMAWTEQQLSRDFFSGSCAGSPYNSRPPSSYGPSLQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | RFX6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RFX6 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: RFX6 Antibody [NBP2-48677] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/22811_RFX6%2520Antibody-Immunohistochemistry-NBP2-48677-img0001.jpg)
Immunohistochemistry: RFX6 Antibody [NBP2-48677] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.