SREBP2 Antibody
| Name | SREBP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89978 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VNLAECAEEKIPPSTLVEIHLTAAMGLKTRCGGKLGFLASYFLSRAQSLCGPEHSAVPDSLRWLCHPLGQKFFMERSWSVKS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SREBP2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SREBF2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: SREBP2 Antibody [NBP1-89978] - Staining of human testis shows strong nuclear positivity in cells of seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/107_SREBP2%2520Antibody-Immunohistochemistry-Paraffin-NBP1-89978-img0005.jpg)
Immunohistochemistry-Paraffin: SREBP2 Antibody [NBP1-89978] - Staining of human testis shows strong nuclear positivity in cells of seminiferous ducts.