DENND1B Antibody
| Name | DENND1B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48832 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:VRTAYKFAKNHAKLGLKEVKSKLKHKENEEDYGTCSSSVQYTPVYKLHNEKGGNSEKRKLAQARLKRPLKSLDGALYDDEDDD |
| Purity/Format | Affinity purified |
| Blocking Peptide | DENND1B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DENND1B |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: DENND1B Antibody [NBP2-48832] - Staining of human oral mucosa shows moderate nuclear positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/23369_DENND1B%2520Antibody-Immunohistochemistry-NBP2-48832-img0001.jpg)
Immunohistochemistry: DENND1B Antibody [NBP2-48832] - Staining of human oral mucosa shows moderate nuclear positivity in squamous epithelial cells.