p53 DINP1 Antibody
| Name | p53 DINP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85108 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | p53 DINP1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TP53INP1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: p53 DINP1 Antibody [NBP1-85108] - Immunohistochemical staining of human cerebral cortex shows nuclear positivity in both neuronal and glial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/23438_p53-DINP1-Antibody-Immunohistochemistry-NBP1-85108-img0003.jpg)
Immunohistochemistry: p53 DINP1 Antibody [NBP1-85108] - Immunohistochemical staining of human cerebral cortex shows nuclear positivity in both neuronal and glial cells.