EAAT2/GLT1 Antibody

Name EAAT2/GLT1 Antibody
Supplier Novus Biologicals
Catalog NBP1-84027
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:SLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNV
Purity/Format Immunogen affinity purified
Blocking Peptide EAAT2/GLT1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene SLC1A2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.