TLE2 Antibody
| Name | TLE2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13435 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: SDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLGSP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TLE2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TLE2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TLE2 Antibody [NBP2-13435] - Immunofluorescent staining of human cell line MCF7 shows localization to nuclear bodies.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19690_TLE2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13435-img0002.jpg)
Immunocytochemistry/Immunofluorescence: TLE2 Antibody [NBP2-13435] - Immunofluorescent staining of human cell line MCF7 shows localization to nuclear bodies.