Melanocortin-5 R/MC5R Antibody

Name Melanocortin-5 R/MC5R Antibody
Supplier Novus Biologicals
Catalog NBP2-14224
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDM
Purity/Format Immunogen affinity purified
Blocking Peptide Melanocortin-5 R/MC5R Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene MC5R
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.