AE Binding Protein 1/ACLP Antibody

Name AE Binding Protein 1/ACLP Antibody
Supplier Novus Biologicals
Catalog NBP2-49432
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids:PPVKPLLPPLPPDYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPKEETDKWAVEKGKDH
Purity/Format Immunogen affinity purified
Blocking Peptide AE Binding Protein 1/ACLP Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene AEBP1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.