RUNX1T1/ETO Antibody

Name RUNX1T1/ETO Antibody
Supplier Novus Biologicals
Catalog NBP2-49644
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids:RNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPT
Purity/Format Immunogen affinity purified
Blocking Peptide RUNX1T1/ETO Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene RUNX1T1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.