SLC22A1 Antibody
| Name | SLC22A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89418 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFIL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC22A1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC22A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SLC22A1 Antibody [NBP1-89418] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules and strong positivity in glomeruli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3467_SLC22A1-Antibody-Immunohistochemistry-NBP1-89418-img0003.jpg)
Immunohistochemistry: SLC22A1 Antibody [NBP1-89418] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules and strong positivity in glomeruli.