SC35 Antibody
| Name | SC35 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47290 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPR |
| Purity/Format | Affinity purified |
| Blocking Peptide | SC35 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SRSF2 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: SC35 Antibody [NBP2-47290] - Analysis of human cell line HEK 293 shows positivity in nucleus & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/24269_SC35%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47290-img0002.jpg)
![Immunohistochemistry: SC35 Antibody [NBP2-47290] - Analysis of human Analysis of human skin tissue. Shows nuclear positivity.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/24270_SC35-Antibody-Immunohistochemistry-NBP2-47290-img0001.jpg)