Anti-c-Rel Antibody

• Supplier: ARP American Research Products
• Catalog: 10-P9741
• Prices: $299.00
• Sizes: 100 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC-P
• Species Reactivities: Human, Mouse, Rat
• Antigen: A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD), different from the related human sequence by four amino acids.
• Purity/Format: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Description: Rabbit Polyclonal
• Gene: Rel