c-Rel Antibody (R31972)

• Supplier: NSJ Bioreagent
• Catalog: R31972
• Prices: $299.00
• Sizes: 100 µg (0.5mg/ml if reconstituted with 0.2ml sterile DI water)
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: Rabbit IgG
• Applications: WB IHC
• Species Reactivities: Human, Mouse, Rat
• Antigen: Amino acids DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD of mouse c-Rel were used as the immunogen for the c-Rel antibody.
• Purity/Format: Antigen affinity
• Description: Rabbit Polyclonal
• Gene: Rel

Product images

Western blot testing of 1) rat kidney and 2) human HeLa lysate with c-Rel antibody. Expected/observed molecular weight ~69 kDa.

IHC testing of human breast cancer tissue with c-Rel antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

IHC testing of mouse intestine with c-Rel antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

IHC testing of rat intestine with c-Rel antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.