| Name | c-Rel, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS178033 |
| Prices | $280.00 |
| Sizes | 100 µg |
| Clonality | Polyclonal |
| Applications | WB IHC-P |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD), different from the related human sequence by four amino acids. |
| Purity/Format | Immunogen Affinity Purified |
| Description | Anti-c-Rel Antibody |
| Gene | Rel |
| Supplier Page | Shop |