Anti-FZD10 / Frizzled 10 Antibody
| Name | Anti-FZD10 / Frizzled 10 Antibody |
|---|---|
| Supplier | LifeSpan Bioscience |
| Catalog | LS-C345414 |
| Prices | $365.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC-P |
| Species Reactivities | Human, Monkey |
| Antigen | The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH. Percent identity by BLAST analysis: Pig, Human (100%); Dog, Horse, Mouse, Bovine (92%). |
| Purity/Format | Immunoaffinity purified |
| Description | Rabbit Polyclonal |
| Gene | FZD10 |
| Conjugate | Unconjugated. Also available conjugated with Biotin , HRP , FITC . |
| Supplier Page | Shop |
Product images
FZD10 Antibody in COS7 cells transfected with chick FZD10 using Immunofluorescence.