TRMT5 antibody
| Name | TRMT5 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA346865 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-TRMT5 antibody: synthetic peptide directed towards the middle region of human TRMT5. Synthetic peptide located within the following region: EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | TRMT5 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TRMT5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysateTRMT5 is supported by BioGPS gene expression data to be expressed in MCF7