PGAM5 Antibody (CL0624)

• Supplier: Novus Biologicals
• Catalog: NBP2-52947
• Prices: $419.00
• Sizes: 100 µl
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1
• Clone: CL0624
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV
• Purity/Format: Protein A purified
• Blocking Peptide: PGAM5 Recombinant Protein Antigen
• Description: Mouse Monoclonal
• Gene: PGAM5
• Conjugate: Unconjugated

Product images

Western Blot: PGAM5 Antibody (CL0624) [NBP2-52947] - Lane 1: Marker [kDa], Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human uterus shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human kidney shows either strong or moderate cytoplasmic immunoreactivity in subsets of renal tubules.

Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human liver shows moderate cytoplasmic immunoreactivity in hepatocytes.

Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human testis shows moderate to strong cytoplasmic positivity in the seminiferous ducts.

Immunohistochemistry-Paraffin: PGAM5 Antibody (CL0624) [NBP2-52947] - Staining of human tonsil shows strong immunoreactivity in germinal center cells.