SLC22A2/OCT2 Antibody (CL0628)

• Supplier: Novus Biologicals
• Catalog: NBP2-52941
• Prices: $419.00
• Sizes: 100 µl
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1
• Clone: CL0628
• Applications: IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR
• Purity/Format: Protein A purified
• Blocking Peptide: SLC22A2/OCT2 Recombinant Protein Antigen
• Description: Mouse Monoclonal
• Gene: SLC22A2
• Conjugate: Unconjugated

Product images

Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody (CL0628) [NBP2-52941] - Staining of human liver shows weak positivity in hepatocytes.

Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody (CL0628) [NBP2-52941] - Staining of human cerebellum shows immunoreactive processes both in molecular and granular cell layers.

Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody (CL0628) [NBP2-52941] - Staining of human cerebral cortex shows strong positivity in astrocytes.

Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody (CL0628) [NBP2-52941] - Staining of human kidney shows strong immunoreactivity in renal tubules.

Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody (CL0628) [NBP2-52941] - Staining of human pancreas shows absence of immunoreactivity.