POLR3E Antibody
| Name | POLR3E Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-58956 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VRPASMTYDDIPHLSAKIKPKQQKVELEMAIDTLNPNYCRSKGEQIALNVDGACADETSTYSSKLMDKQTFCSSQTTSNTSRYAAALYRQGELHLTPLHGILQLRPSFSYLDK |
| Purity/Format | Affinity purified |
| Blocking Peptide | POLR3E Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | POLR3E |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: POLR3E Antibody [NBP2-58956] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7345_POLR3E%2520Antibody-Western%2520Blot-NBP2-58956-img0002.jpg)
Western Blot: POLR3E Antibody [NBP2-58956] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
![Immunocytochemistry/Immunofluorescence: POLR3E Antibody [NBP2-58956] - Staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7346_POLR3E-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58956-img0001.jpg)
Immunocytochemistry/Immunofluorescence: POLR3E Antibody [NBP2-58956] - Staining of human cell line U-2 OS shows localization to nucleoplasm.