ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody
| Name | ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-55496 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFMVKGGEKHVEWVNAL |
| Purity/Format | Affinity purified |
| Blocking Peptide | ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ST8SIA4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody [NBP2-55496] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10520_ST8%2520alpha-2-8-Sialyltransferase%25204-ST8SIA4%2520Antibody-Western%2520Blot-NBP2-55496-img0002.jpg)
Western Blot: ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody [NBP2-55496] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
![Immunocytochemistry/Immunofluorescence: ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody [NBP2-55496] - Staining of human cell line A549 shows localization to the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10521_ST8-alpha-2-8-Sialyltransferase-4-ST8SIA4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55496-img0001.jpg)
Immunocytochemistry/Immunofluorescence: ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody [NBP2-55496] - Staining of human cell line A549 shows localization to the Golgi apparatus.