Signal peptide peptidase-like 2B Antibody
| Name | Signal peptide peptidase-like 2B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-55073 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YWAGSRDVKKRYMKHKRDDGPEKQEDEAVDV |
| Purity/Format | Affinity purified |
| Blocking Peptide | Signal peptide peptidase-like 2B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SPPL2B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Signal peptide peptidase-like 2B Antibody [NBP2-55073] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11297_Signal%2520peptide%2520peptidase-like%25202B%2520Antibody-Western%2520Blot-NBP2-55073-img0002.jpg)
Western Blot: Signal peptide peptidase-like 2B Antibody [NBP2-55073] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
![Immunocytochemistry/Immunofluorescence: Signal peptide peptidase-like 2B Antibody [NBP2-55073] - Staining of human cell line SiHa shows localization to nucleoplasm, plasma membrane & centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11298_Signal-peptide-peptidase-like-2B-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55073-img0001.jpg)
Immunocytochemistry/Immunofluorescence: Signal peptide peptidase-like 2B Antibody [NBP2-55073] - Staining of human cell line SiHa shows localization to nucleoplasm, plasma membrane & centrosome.