cGAS Antibody
| Name | cGAS Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-55374 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNLIDKRSKEFLTKQIEYER |
| Purity/Format | Affinity purified |
| Blocking Peptide | cGAS Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MB21D1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: cGAS Antibody [NBP2-55374] - Staining of human cell line U-2 OS shows localization to microtubule organizing center.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20097_cGAS-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55374-img0001.jpg)
Immunocytochemistry/Immunofluorescence: cGAS Antibody [NBP2-55374] - Staining of human cell line U-2 OS shows localization to microtubule organizing center.
![Immunohistochemistry-Paraffin: cGAS Antibody [NBP2-55374] - Immunohistochemical staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20098_cGAS%2520Antibody-Immunohistochemistry-Paraffin-NBP2-55374-img0002.jpg)
Immunohistochemistry-Paraffin: cGAS Antibody [NBP2-55374] - Immunohistochemical staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.