CBFA2T3 Antibody
| Name | CBFA2T3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-57636 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKASAMPDSPAEVKTQPR |
| Purity/Format | Affinity purified |
| Blocking Peptide | CBFA2T3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CBFA2T3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CBFA2T3 Antibody [NBP2-57636] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20578_CBFA2T3%2520Antibody-Western%2520Blot-NBP2-57636-img0002.jpg)
Western Blot: CBFA2T3 Antibody [NBP2-57636] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
![Immunohistochemistry-Paraffin: CBFA2T3 Antibody [NBP2-57636] - Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal and non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20579_CBFA2T3-Antibody-Immunohistochemistry-Paraffin-NBP2-57636-img0001.jpg)
Immunohistochemistry-Paraffin: CBFA2T3 Antibody [NBP2-57636] - Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal and non-germinal center cells.