Xanthine Oxidase Antibody
| Name | Xanthine Oxidase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-57577 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GFVCFISADDVPGSNITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIEDAIKNNSFYGPELKIEKGDLKK |
| Purity/Format | Affinity purified |
| Blocking Peptide | Xanthine Oxidase Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | XDH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Xanthine Oxidase Antibody [NBP2-57577] - Staining of human cell line U-251 MG shows localization to nucleus & microtubule organizing center.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20580_Xanthine-Oxidase-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57577-img0001.jpg)
Immunocytochemistry/Immunofluorescence: Xanthine Oxidase Antibody [NBP2-57577] - Staining of human cell line U-251 MG shows localization to nucleus & microtubule organizing center.
![Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody [NBP2-57577] - Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in subset of renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20581_Xanthine%2520Oxidase%2520Antibody-Immunohistochemistry-Paraffin-NBP2-57577-img0002.jpg)
Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody [NBP2-57577] - Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in subset of renal tubules.