Ataxin 7-Like 3 Antibody
| Name | Ataxin 7-Like 3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-56183 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSAVLPEVESSLDNDSFDMTDSQALISRL |
| Purity/Format | Affinity purified |
| Blocking Peptide | Ataxin 7-Like 3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ATXN7L3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Ataxin 7-Like 3 Antibody [NBP2-56183] - Staining of human cell line SH-SY5Y shows localization to nuclear speckles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20644_Ataxin-7-Like-3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56183-img0001.jpg)
Immunocytochemistry/Immunofluorescence: Ataxin 7-Like 3 Antibody [NBP2-56183] - Staining of human cell line SH-SY5Y shows localization to nuclear speckles.
![Immunocytochemistry/Immunofluorescence: Ataxin 7-Like 3 Antibody [NBP2-56183] - Immunohistochemical staining of human small intestine shows nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20645_Ataxin%25207-Like%25203%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56183-img0002.jpg)
Immunocytochemistry/Immunofluorescence: Ataxin 7-Like 3 Antibody [NBP2-56183] - Immunohistochemical staining of human small intestine shows nuclear positivity in glandular cells.