TMEM188 Antibody

Name TMEM188 Antibody
Supplier Novus Biologicals
Catalog NBP2-58839
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('HKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQ',)
Purity/Format Affinity purified
Blocking Peptide TMEM188 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene CNEP1R1
Conjugate Unconjugated
Supplier Page Shop

Product images