KCNMB4 Antibody
| Name | KCNMB4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-56583 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CWLSPALQDLQATEANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQV |
| Purity/Format | Affinity purified |
| Blocking Peptide | KCNMB4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KCNMB4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: KCNMB4 Antibody [NBP2-56583] - Staining of human cell line RT4 shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/1576_KCNMB4%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56583-img0001.jpg)
Immunocytochemistry/Immunofluorescence: KCNMB4 Antibody [NBP2-56583] - Staining of human cell line RT4 shows localization to cytosol.