Name | SOX3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP2-59060 |
Prices | $419.00 |
Sizes | 100 µl |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG1 |
Applications | WB |
Species Reactivities | Human |
Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RENSSGARSPRVPADLARSILISLPFPPDSLAHRPPSSAPTESQGLFTVAAPAPGAPSPPATLAHLLPAPAMYSLLETELKNPVGTPTQAAGTGGPAAPGGAGKSSA |
Purity/Format | Protein A purified |
Blocking Peptide | SOX3 Recombinant Protein Antigen |
Description | Mouse Monoclonal |
Gene | SOX3 |
Conjugate | Unconjugated |
Supplier Page | Shop |