GRK1 Antibody

Name GRK1 Antibody
Supplier Novus Biologicals
Catalog NBP2-55226
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKKLFQQFLQSA
Purity/Format Affinity purified
Blocking Peptide GRK1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene GRK1
Conjugate Unconjugated
Supplier Page Shop

Product images