CCDC109A Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-59029
• Prices: $419.00
• Sizes: 100 µl
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1
• Applications: WB ICC/IF
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGE
• Purity/Format: Protein A purified
• Description: Mouse Monoclonal
• Gene: MCU
• Conjugate: Unconjugated