Aminopeptidase O/ONPEP Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-57309
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: ICC/IF
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LFDTDTWSLQIRKTGAQTATDFPHAIRIWYKTKPEGRSVTWTSDQSGRPCVYTVGSPINNRALFPCQEPPVAMSTWQATVRAAASFVVLMSGENSAKPT
• Purity/Format: Affinity purified
• Blocking Peptide: Aminopeptidase O/ONPEP Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: C9orf3
• Conjugate: Unconjugated