| Name | Anti-IL21 Antibody (N-Terminus) |
|---|---|
| Supplier | LifeSpan Bioscience |
| Catalog | LS-C8216 |
| Prices | $485.00 |
| Sizes | 50 µg |
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF ELISA |
| Species Reactivities | Human |
| Antigen | IL21 antibody was raised against synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to N-terminus of human IL-21. Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Marmoset (97%); Bat, Bovine, Horse (93%); Elephant, Dog (90%); Panda, Porcine (83%). |
| Purity/Format | Immunoaffinity purified |
| Description | Goat Polyclonal |
| Gene | IL21 |
| Supplier Page | Shop |