Anti-IL21 Antibody (aa33-61)
| Name | Anti-IL21 Antibody (aa33-61) |
|---|---|
| Supplier | LifeSpan Bioscience |
| Catalog | LS-C83971 |
| Prices | $455.00 |
| Sizes | 100 µg |
| Host | Goat |
| Clonality | Polyclonal |
| Applications | IHC-P WB |
| Species Reactivities | Human |
| Antigen | IL21 antibody was raised against synthetic peptide C-RHLIDIVEQLKIYENDLDPELLSAPQDVK corresponding to N-terminus of mouse IL-21. Percent identity by BLAST analysis: Mouse (100%); Rat (93%); Hamster (86%). |
| Purity/Format | Immunoaffinity purified |
| Description | Goat Polyclonal |
| Gene | IL21 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
IHC of IL-21 antibody LS-C83971. Mouse spleen.