Anti-IL21 Antibody (aa40-68)

• Supplier: LifeSpan Bioscience
• Catalog: LS-C187848
• Prices: $375.00
• Sizes: 50 µg
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC-P WB
• Species Reactivities: Human
• Antigen: IL21 antibody was raised against synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to amino acids 40-68 within the N-terminal region of human IL-21. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan (100%); Gibbon, Monkey, Marmoset (97%); Sheep, Bovine, Horse (93%); Elephant, Dog (90%); Panda, Cat, Pig (83%).
• Purity/Format: Affinity purified
• Description: Goat Polyclonal
• Gene: IL21
• Conjugate: Unconjugated