Anti-INHBC Antibody (aa82-113)

• Supplier: LifeSpan Bioscience
• Catalog: LS-C121340
• Prices: $485.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1
• Applications: IHC-P WB ELISA
• Species Reactivities: Human, Hamster
• Antigen: INHBC antibody was raised against synthetic peptide, VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC, corresponding to aa82-113 of mature human activin BetaC-subunit. Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Hamster, Elephant, Panda (100%); Marmoset, Mouse, Rat, Bovine, Bat, Dog (97%); Rabbit, Horse (94%); Pig (84%).
• Purity/Format: Protein G purified
• Description: Mouse Monoclonal
• Gene: INHBC