Name | Anti-INHBC Antibody (aa82-113, clone betaC clone 1) |
---|---|
Supplier | LifeSpan Bioscience |
Catalog | LS-C58121 |
Prices | $305.00 |
Sizes | 50 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG1 |
Applications | IHC ICC/IF WB IP FC ELISA RIA |
Species Reactivities | Human |
Antigen | INHBC antibody was raised against synthetic peptide sequence VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC corresponding to amino acids 82-113 of mature human activin BetaC-subunit. Percent identity by BLAST analysis: Human, Panda (100%); Mouse, Rat, Bovine, Dog (97%); Porcine (84%). |
Purity/Format | Affinity purified |
Description | Mouse Monoclonal |
Gene | INHBC |
Conjugate | Unconjugated |
Supplier Page | Shop |