Name | Anti-INHBC Antibody (aa82-113) |
---|---|
Supplier | LifeSpan Bioscience |
Catalog | LS-C121341 |
Prices | $415.00 |
Sizes | 50 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG1 |
Applications | IHC-P WB ELISA |
Species Reactivities | Human, Hamster |
Antigen | INHBC antibody was raised against synthetic peptide, VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC, corresponding to aa82-113 of mature human activin BetaC-subunit. Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Hamster, Elephant, Panda (100%); Marmoset, Mouse, Rat, Bovine, Bat, Dog (97%); Rabbit, Horse (94%); Pig (84%). |
Purity/Format | Protein G purified |
Description | Mouse Monoclonal |
Gene | INHBC |
Supplier Page | Shop |