| Name | Anti-c-Rel-Picoband-trade-Antibody |
|---|---|
| Supplier | Abgent, a WuXi AppTec company |
| Catalog | ABO12427 |
| Prices | $240.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC-P |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD), different from the related human sequence by four amino acids. |
| Purity/Format | Lyophilized |
| Description | Rabbit Polyclonal |
| Gene | Rel |
| Supplier Page | Shop |