Anti-PGIS / PTGIS Antibody (aa299-329) IHC-plusâ¢
| Name | Anti-PGIS / PTGIS Antibody (aa299-329) IHC-plus⢠|
|---|---|
| Supplier | LifeSpan Bioscience |
| Catalog | LS-B1615 |
| Prices | $395.00 |
| Sizes | 1 ea |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IP |
| Species Reactivities | Bovine, Mouse, Rat, Guinea Pig, Rabbit, Sheep |
| Antigen | PGIS / PTGIS antibody was raised against bovine PGIS amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT). Percent identity by BLAST analysis: Bovine (100%); Horse, Pig (87%); Gibbon, Monkey, Bat (83%); Human (80%). |
| Purity/Format | Immunoaffinity purified |
| Description | Rabbit Polyclonal |
| Gene | PTGIS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PTGIS antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B1615 concentration 5 ug/ml.