| Name | Anti-SDF-1 / CXCL12 Antibody |
|---|---|
| Supplier | LifeSpan Bioscience |
| Catalog | LS-C47461 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ELISA |
| Species Reactivities | Human, Monkey, Rat, Bat, Rabbit |
| Antigen | SDF-1 / CXCL12 antibody was raised against amino acid 21-93 (GKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM) of human SDF-1 protein was used as the immunogen |
| Description | Rabbit Polyclonal |
| Gene | CXCL12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |