Name | Anti-TLR5 Antibody (aa151-181) |
---|---|
Supplier | LifeSpan Bioscience |
Catalog | LS-C83963 |
Prices | $455.00 |
Sizes | 200 µg |
Host | Goat |
Clonality | Polyclonal |
Applications | IHC-P WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | TLR5 antibody was raised against synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Macaque, Monkey, Spider monkey, Siamang (100%); Colobus monkey, Baboon (97%); Marmoset (94%); Sheep, Goat, Panda, Water buffalo (84%); Zebu, Bovine (81%). |
Purity/Format | Immunoaffinity purified |
Description | Goat Polyclonal |
Gene | TLR5 |
Conjugate | Unconjugated |
Supplier Page | Shop |