Anti-TLR5 Antibody (aa151-181)

Name Anti-TLR5 Antibody (aa151-181)
Supplier LifeSpan Bioscience
Catalog LS-C83963
Prices $455.00
Sizes 200 µg
Host Goat
Clonality Polyclonal
Applications IHC-P WB
Species Reactivities Human, Mouse, Rat
Antigen TLR5 antibody was raised against synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Macaque, Monkey, Spider monkey, Siamang (100%); Colobus monkey, Baboon (97%); Marmoset (94%); Sheep, Goat, Panda, Water buffalo (84%); Zebu, Bovine (81%).
Purity/Format Immunoaffinity purified
Description Goat Polyclonal
Gene TLR5
Conjugate Unconjugated
Supplier Page Shop