GATA-2 Antibody
| Name | GATA-2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82581 |
| Prices | $3.00, $129.00, $419.00, $95,000.00 |
| Sizes | 100 µl, 25 µl, 100 µl, 25 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-F IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GATA-2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GATA2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GATA-2 Antibody [NBP1-82581] - Analysis in human cell line HELA.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/86_GATA-2-Antibody-Western-Blot-NBP1-82581-img0011.jpg)
Western Blot: GATA-2 Antibody [NBP1-82581] - Analysis in human cell line HELA.
![Immunocytochemistry/Immunofluorescence: GATA-2 Antibody [NBP1-82581] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/87_GATA-2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82581-img0012.jpg)
Immunocytochemistry/Immunofluorescence: GATA-2 Antibody [NBP1-82581] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581] - Staining of human prostate shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/88_GATA-2-Antibody-Immunohistochemistry-Paraffin-NBP1-82581-img0008.jpg)
Immunohistochemistry-Paraffin: GATA-2 Antibody [NBP1-82581] - Staining of human prostate shows strong nuclear positivity in glandular cells.
![Simple Western: GATA-2 Antibody [NBP1-82581] - Simple Western lane view shows a specific band for GATA2 in 0.2 mg/ml of HEL lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/89_GATA-2-Antibody-Simple-Western-NBP1-82581-img0006.jpg)
Simple Western: GATA-2 Antibody [NBP1-82581] - Simple Western lane view shows a specific band for GATA2 in 0.2 mg/ml of HEL lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: GATA-2 Antibody [NBP1-82581] - Electropherogram image(s) of corresponding Simple Western lane view. GATA-2 antibody was used at 1:100 dilution on HELA lysate(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/90_GATA-2-Antibody-Simple-Western-NBP1-82581-img0007.jpg)
Simple Western: GATA-2 Antibody [NBP1-82581] - Electropherogram image(s) of corresponding Simple Western lane view. GATA-2 antibody was used at 1:100 dilution on HELA lysate(s).