GATA-2 Recombinant Protein Antigen

Name GATA-2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-82581PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody GATA-2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene GATA2
Sequence LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG
Description A recombinant protein antigen corresponding to GATA2
Supplier Page Shop