FCHO2 Antibody
| Name | FCHO2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32694 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FCHO2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FCHO2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FCHO2 Antibody [NBP2-32694] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/1790_FCHO2-Antibody-Western-Blot-NBP2-32694-img0006.jpg)
Western Blot: FCHO2 Antibody [NBP2-32694] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
![Simple Western: FCHO2 Antibody [NBP2-32694] - Simple Western lane view shows a specific band for FCHO2 in 0.2 mg/ml of RT-4 (left), A431 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/1795_FCHO2-Antibody-Simple-Western-NBP2-32694-img0009.jpg)
Simple Western: FCHO2 Antibody [NBP2-32694] - Simple Western lane view shows a specific band for FCHO2 in 0.2 mg/ml of RT-4 (left), A431 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: FCHO2 Antibody [NBP2-32694] - Electropherogram image(s) of corresponding Simple Western lane view. FCHO2 antibody was used at 1:20 dilution on RT-4 and A431 lysate(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/1796_FCHO2%2520Antibody-Simple%2520Western-NBP2-32694-img0010.jpg)
Simple Western: FCHO2 Antibody [NBP2-32694] - Electropherogram image(s) of corresponding Simple Western lane view. FCHO2 antibody was used at 1:20 dilution on RT-4 and A431 lysate(s).