DDX21 Antibody
| Name | DDX21 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83310 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ChIP ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DDX21 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DDX21 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DDX21 Antibody [NBP1-83310] - Analysis in human cell line HL-60.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/636_DDX21-Antibody-Western-Blot-NBP1-83310-img0006.jpg)
Western Blot: DDX21 Antibody [NBP1-83310] - Analysis in human cell line HL-60.
![Immunocytochemistry/Immunofluorescence: DDX21 Antibody [NBP1-83310] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/637_DDX21%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83310-img0007.jpg)
Immunocytochemistry/Immunofluorescence: DDX21 Antibody [NBP1-83310] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.
![Immunohistochemistry-Paraffin: DDX21 Antibody [NBP1-83310] - Staining of human stomach shows strong nucleolar positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/638_DDX21-Antibody-Immunohistochemistry-Paraffin-NBP1-83310-img0002.jpg)
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP1-83310] - Staining of human stomach shows strong nucleolar positivity in glandular cells.