LPCAT2 Antibody
| Name | LPCAT2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88921 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-F IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LPCAT2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LPCAT2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LPCAT2 Antibody [NBP1-88921] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/892_LPCAT2-Antibody-Western-Blot-NBP1-88921-img0010.jpg)
Western Blot: LPCAT2 Antibody [NBP1-88921] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
![Immunocytochemistry/Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & lipid droplets.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/893_LPCAT2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88921-img0011.jpg)
Immunocytochemistry/Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & lipid droplets.
![Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/894_LPCAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-88921-img0008.jpg)
Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
![Western Blot: LPCAT2 Antibody [NBP1-88921] - Analysis in human thyroid gland tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/895_LPCAT2-Antibody-Western-Blot-NBP1-88921-img0009.jpg)
Western Blot: LPCAT2 Antibody [NBP1-88921] - Analysis in human thyroid gland tissue.
![Immunocytochemistry/Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of murine cell line RAW264.7. Image provided by product review by verified customer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/896_LPCAT2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88921-img0005.jpg)
Immunocytochemistry/Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of murine cell line RAW264.7. Image provided by product review by verified customer.
![Immunocytochemistry/Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of human cell line A-431 shows positivity in endoplasmic reticulum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/897_LPCAT2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88921-img0003.jpg)
Immunocytochemistry/Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of human cell line A-431 shows positivity in endoplasmic reticulum.
![Immunohistochemistry-Frozen: LPCAT2 Antibody [NBP1-88921] - Staining of LPCAT2 in rat neuronal tissue using anti-LPCAT2 antibody. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/898_LPCAT2-Antibody-Immunohistochemistry-Frozen-NBP1-88921-img0007.jpg)
Immunohistochemistry-Frozen: LPCAT2 Antibody [NBP1-88921] - Staining of LPCAT2 in rat neuronal tissue using anti-LPCAT2 antibody. Image from verified customer review.