TDO2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-54877
• Prices: $369.00
• Sizes: 50 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to TDO2(tryptophan 2,3-dioxygenase) The peptide sequence was selected from the N terminal of TDO2 (NP_005642). Peptide sequence LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: TDO2
• Conjugate: Unconjugated