TMPRSS4 Antibody
| Name | TMPRSS4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56991 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TMPRSS4 (transmembrane protease, serine 4) The peptide sequence was selected from the middle region of TMPRSS4. Peptide sequence LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TMPRSS4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: TMPRSS4 Antibody [NBP1-56991] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8839_TMPRSS4-Antibody-Western-Blot-NBP1-56991-img0004.jpg)
![Western Blot: TMPRSS4 Antibody [NBP1-56991] - Human breast cancer cell line SKBR3 and Positive control. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8840_TMPRSS4-Antibody-Western-Blot-NBP1-56991-img0003.jpg)