BACH1 Antibody
| Name | BACH1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88722 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:EPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFLKFKFLDSTADQQECPRKKCFSSHCQKTDLKLSLLDQRDLETDEVEEFLENKNVQTPQCKLRRYQGNAKASPPLQDSASQTYESMCLEKDAALA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BACH1 Protein |
| Description | Rabbit Polyclonal |
| Gene | BRIP1 |
| Supplier Page | Shop |
Product images
![Western Blot: BACH1 Antibody [NBP1-88722] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/9621_BACH1%2520Antibody-Western%2520Blot-NBP1-88722-img0004.jpg)
Western Blot: BACH1 Antibody [NBP1-88722] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: BACH1 Antibody [NBP1-88722] - Staining of human cell line A-431 shows positivity in nuclei but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/9622_BACH1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88722-img0003.jpg)
Immunocytochemistry/Immunofluorescence: BACH1 Antibody [NBP1-88722] - Staining of human cell line A-431 shows positivity in nuclei but not nucleoli.
![Immunohistochemistry-Paraffin: BACH1 Antibody [NBP1-88722] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/9623_BACH1-Antibody-Immunohistochemistry-Paraffin-NBP1-88722-img0001.jpg)
Immunohistochemistry-Paraffin: BACH1 Antibody [NBP1-88722] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
![Simple Western: BACH1 Antibody [NBP1-88722] - Simple Western lane view shows a specific band for BACH1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/9624_BACH1-Antibody-Simple-Western-NBP1-88722-img0005.jpg)
Simple Western: BACH1 Antibody [NBP1-88722] - Simple Western lane view shows a specific band for BACH1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Product References
Antibody-based protein profiling of the human chromosome 21. - Antibody-based protein profiling of the human chromosome 21.
Uhlen M, Oksvold P, Algenas C, Hamsten C, Fagerberg L, Klevebring D, Lundberg E, Odeberg J, Ponten F, Kondo T, Sivertsson A. Mol Cell Proteomics. 2012 Mar;11(3):M111.013458.
Transcriptional network analysis identifies BACH1 as a master regulator of breast - Transcriptional network analysis identifies BACH1 as a master regulator of breast
Liang Y, Wu H, Lei R, Chong RA, Wei Y, Lu X, Tagkopoulos I, Kung SY, Yang Q, Hu G, Kang Y. J Biol Chem. 2012 Sep 28;287(40):33533-44. Epub 2012 Aug 8.